PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK29014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 231aa    MW: 26960.5 Da    PI: 9.5036
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK29014.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM134.38.3e-4251373127
        NAM   3 pGfrFhPtdeelvveyLkkkvegkklelee....vikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                pGfrF Pt+eel+++yL++k+eg++ +l++    vi+ + iy+++PwdLp+    +++++ ++++fF+ r++++a+g r++r t+sgyWkatg+   v+s
  PK29014.1   5 PGFRFYPTEEELISFYLHNKLEGEREDLNRvinrVIPLLPIYEFNPWDLPRysgvACQGDPEQCFFFIARQESEARGGRPSRLTESGYWKATGSPSYVYS 104
                9************************555542222567778**********54665555577799************************************ PP

        NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyr 127
                ++++ +glk+t+vfy+grap+g+kt+W m+ey+
  PK29014.1 105 SRNRIIGLKRTMVFYNGRAPHGTKTQWKMNEYK 137
                ********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100544.3893169IPR003441NAC domain
PfamPF023652.4E-215137IPR003441NAC domain
SuperFamilySSF1019414.71E-445169IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
KSRIPGFRFY PTEEELISFY LHNKLEGERE DLNRVINRVI PLLPIYEFNP WDLPRYSGVA  60
CQGDPEQCFF FIARQESEAR GGRPSRLTES GYWKATGSPS YVYSSRNRII GLKRTMVFYN  120
GRAPHGTKTQ WKMNEYKAIQ GEPTTTPSAT ISHLPLLRQE FSLCRVYKKT KCLRAFDRRP  180
TREEIITINP TTTTTTLDHH HHQHQPSSLP PQWWPAFSKC GERVLEHSNF D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-30516919165NO APICAL MERISTEM PROTEIN
1ut4_B3e-30516919165NO APICAL MERISTEM PROTEIN
1ut7_A3e-30516919165NO APICAL MERISTEM PROTEIN
1ut7_B3e-30516919165NO APICAL MERISTEM PROTEIN
3swm_A3e-30516922168NAC domain-containing protein 19
3swm_B3e-30516922168NAC domain-containing protein 19
3swm_C3e-30516922168NAC domain-containing protein 19
3swm_D3e-30516922168NAC domain-containing protein 19
3swp_A3e-30516922168NAC domain-containing protein 19
3swp_B3e-30516922168NAC domain-containing protein 19
3swp_C3e-30516922168NAC domain-containing protein 19
3swp_D3e-30516922168NAC domain-containing protein 19
4dul_A3e-30516919165NAC domain-containing protein 19
4dul_B3e-30516919165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008243510.12e-96PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR37e-71NAC90_ARATH; NAC domain-containing protein 90
TrEMBLM5VSR51e-95M5VSR5_PRUPE; Uncharacterized protein
STRINGGLYMA03G35570.16e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87134123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.13e-72NAC domain containing protein 90